Trending

#Drizzle

Latest posts tagged with #Drizzle on Bluesky

Posts tagged #Drizzle

A darkening shelf of low cloud over a town scape

A darkening shelf of low cloud over a town scape

This is when the alien craft breaks through the clouds. An amazing shelf over the town.

#Clouds
#Weather
#Australia
#Drizzle
#Photography
#ShotOnOppo
#Gunaikurnai country is different

7 0 1 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

1 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

1 0 0 0
Preview
We did at least not get the snow. The morning was anything but nice here, very windy and the wind was chilling col plus some drizzle mixed in but I see us as the lucky ones because an area south of us had snow. Not that the …

Nasty morning but the afternoon turned out to be rather nice.

#spring #cold #windy #drizzle #sunny #warmish #sowing_and_growing #gardening

New blog: thecottagebythecranelake.blog/2026/03/30/w...

13 0 0 0
Preview
Aurora PostgreSQL Serverless (Express configuration) with CDK and Drizzle Introduction This post documents a setup for Aurora PostgreSQL express configuration...

✍️ New blog post by Johannes Konings

Aurora PostgreSQL Serverless (Express configuration) with CDK and Drizzle

#aws #cdk #aurora #drizzle

1 0 0 0
A minimally deterministic finite state machine, equivalent to the regular expression (drip+(ing)?){1}|(driz+le){1}|(diverse){1}

A minimally deterministic finite state machine, equivalent to the regular expression (drip+(ing)?){1}|(driz+le){1}|(diverse){1}

#dripping #drizzle #diverse

3 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #lemonricottapancakeswithberrycompote&proteindrizzle #lemon #ricotta #pancakes #with #berry #compote #protein #drizzle #whole #all-purpose #large #mixed

0 0 0 0
How I Structured User Data for My AI SaaS - prodSens.live Most developers building their first SaaS make the same mistake I almost made — they reach for sessionStorage…

How I Structured User Data for My AI SaaS Most developers building their first SaaS make the same mistake I almost made — they reach for sessionStorage… The post How I Structured User Data for ...

#Software #drizzle #nextjs #postgres #prodsens #live #saas

Origin | Interest | Match

1 0 0 0
How I Structured User Data for My AI SaaS - prodSens.live Most developers building their first SaaS make the same mistake I almost made — they reach for sessionStorage…

How I Structured User Data for My AI SaaS Most developers building their first SaaS make the same mistake I almost made — they reach for sessionStorage… The post How I Structured User Data for ...

#Software #drizzle #nextjs #postgres #prodsens #live #saas

Origin | Interest | Match

1 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #za'atarcrustedhalloumi&roastedvegetablesheetpanwithtahinidrizzle #za'atar #crusted #halloumi #roasted #vegetable #sheet #with #tahini #drizzle #mixed #olive

0 0 0 0
Preview
I’ll remember this storm :-) I’ve realised that if I write the text to the photo before loading it down here the photo becomes really big. This photo was taken by my neighbour when she came back home from work. Just a sh…

The wind has finally calmed down so no roar to keep me awake all night long 😀

#storm #windy #drizzle #spring

New blog: thecottagebythecranelake.blog/2026/03/13/i...

10 1 2 0
Grey day on Toronto road

Grey day on Toronto road

Grey day on Toronto road

Grey day on Toronto road

Cloudy and foggy in the valley #Toronto #explore #winter #DVP #fog #drizzle

6 0 0 0
Photograph taken not long before dusk in the drizzle outside the visitor centre at OM Dark Sky Park, Davagh Forest. Had time for a soggy wander before attending a brilliant astronomy talk.

Image shows a silver birch tree leaning slightly with an unruly mass of twisted leaf-free branches reaching upwards. The tree contrasts with the surrounding forest of evergreens. Sky is a pale blue-grey from the mist and drizzle.

Amazing place to visit if you're in Northern Ireland. Further details at www.omdarksky.com

Photograph taken not long before dusk in the drizzle outside the visitor centre at OM Dark Sky Park, Davagh Forest. Had time for a soggy wander before attending a brilliant astronomy talk. Image shows a silver birch tree leaning slightly with an unruly mass of twisted leaf-free branches reaching upwards. The tree contrasts with the surrounding forest of evergreens. Sky is a pale blue-grey from the mist and drizzle. Amazing place to visit if you're in Northern Ireland. Further details at www.omdarksky.com

Contrast at Dusk
for #ForestFriday

Moody shot for this week! Detail in the alt text.

#EastCoastKin #photography #forest #trees #dusk #drizzle
#OMDarkSkyPark #Omagh #DavaghForest #darksky #SperrinMountains #NorthernIreland
(iPhone camera)

98 11 4 1
Original post on newsie.social

NORTHLAND FORECAST FOR MARCH 6, 2026:

The #fog and #freezing #drizzle will persist across the #Northland Thursday night, especially near #LakeSuperior, with low #temperatures in the 20s and low 30s.

A #storm system will bring increased #rain #shower chances Friday with light #winds and highs […]

0 1 1 0
Post image Post image Post image

#Springtime with some #drizzle is on it's way
#jonquils 🤩

0 0 0 0
The satellite and radar over the Northland at 1:30 p.m. on March 5, 2026, does not show the drizzle that is falling across parts of the region.  Cloud cover is persistent on the Minnesota side, with some breaks in the Bayfield Peninsula, Upper Peninsula, and Arrowhead regions.

The satellite and radar over the Northland at 1:30 p.m. on March 5, 2026, does not show the drizzle that is falling across parts of the region. Cloud cover is persistent on the Minnesota side, with some breaks in the Bayfield Peninsula, Upper Peninsula, and Arrowhead regions.

A Winter Weather Advisory continues for Bayfield, Carlton, Cook, Douglas, and St. Louis counties through midnight Thursday, March 5, 2026, for the likelihood of freezing drizzle due to fog coming off Lake Superior the rest of the day.  The drizzle has been leading to ice accumulations on roadways and surfaces.

A Winter Weather Advisory continues for Bayfield, Carlton, Cook, Douglas, and St. Louis counties through midnight Thursday, March 5, 2026, for the likelihood of freezing drizzle due to fog coming off Lake Superior the rest of the day. The drizzle has been leading to ice accumulations on roadways and surfaces.

Temperatures in the Northland just after 1 p.m. on March 5, 2026, range from 23 to 37 degrees Fahrenheit.  Temperatures are below freezing along Lake Superior and northeast Minnesota.

Temperatures in the Northland just after 1 p.m. on March 5, 2026, range from 23 to 37 degrees Fahrenheit. Temperatures are below freezing along Lake Superior and northeast Minnesota.

Wind speeds in the Northland just after 1 p.m. on March 5, 2026, range from calm to 16 mph.  Wind direction is primarily from the east, northeast, and southeast.

Wind speeds in the Northland just after 1 p.m. on March 5, 2026, range from calm to 16 mph. Wind direction is primarily from the east, northeast, and southeast.

Happy #Thursday afternoon from the #Northland.

It is a #colder but #seasonal day in the region thanks to persistent #cloud cover and #fog near #LakeSuperior.

That fog and the #freezing #drizzle it contains will create some #slick spots on area roadways and […]

[Original post on newsie.social]

0 1 0 0
A Dense Fog Advisory is in effect until noon for Thursday, March 5, 2026, for Aitkin, Ashland, Bayfield, Carlton, Cook, Douglas, Iron, Itasca, Lake, Pine, and central and southern St. Louis counties.  Fog will be dense at times, reducing visibility down to about one-quarter of a mile.

A Dense Fog Advisory is in effect until noon for Thursday, March 5, 2026, for Aitkin, Ashland, Bayfield, Carlton, Cook, Douglas, Iron, Itasca, Lake, Pine, and central and southern St. Louis counties. Fog will be dense at times, reducing visibility down to about one-quarter of a mile.

A Winter Weather Advisory is in effect for the Twin Ports and North Shore regions of the Northland through noon Thursday, March 5, 2026.  Fog in this area, combined with temperatures below freezing, will cause the drizzle to freeze on surfaces such as roadways and sidewalks.  Be prepared for slick spots through Thursday morning.

A Winter Weather Advisory is in effect for the Twin Ports and North Shore regions of the Northland through noon Thursday, March 5, 2026. Fog in this area, combined with temperatures below freezing, will cause the drizzle to freeze on surfaces such as roadways and sidewalks. Be prepared for slick spots through Thursday morning.

FOG AND FREEZING DRIZZLE:

The #fog coming from #LakeSuperior is covering more areas of the #Northland as we go into Wednesday night. It will persist through Thursday morning.

#Temperatures are also below #freezing, so the #drizzle could make surfaces and […]

[Original post on newsie.social]

0 1 0 0
Post image

Current conditions on Grand Lake, Ohio: 37° feels like 32°
#lifeisGRAND #OhioBlues #cottonwood2026 #fogadvisory⚠️ #drizzle #shadesofgrey

0 0 0 0
Post image

Current conditions on Grand Lake, Ohio: 33° feels like 28°
#lifeisGRAND #OhioBlues #cottonwood2026 #fogrollingin #drizzle #shadesofgrey

0 0 0 0
Preview
Developing a Tailored Config Module for NestJS Applications Have you ever struggled with more environment variables than actual features? DATABASE_URL,...

Developing a Tailored Config Module for NestJS Applications Have you ever struggled with more environment variables than actual features? DATABASE_URL , SUPABASE_URL , JWT_SECRET , a couple of flag...

#nestjs #drizzle #supabase #restapi

Origin | Interest | Match

1 0 0 0
Video

damp walk #Peterborough #Cambridgeshire #uk #loveukweather #ukweather #drizzle

1 0 0 0
The satellite and radar over the Northland at 1:45 p.m. on February 8, 2026, shows cloud cover across the region, with no precipitation being detected by the radar.

The satellite and radar over the Northland at 1:45 p.m. on February 8, 2026, shows cloud cover across the region, with no precipitation being detected by the radar.

Temperatures in the Northland just after 1:30 p.m. on February 8, 2026, range from 19 to 27 degrees Fahrenheit.

Temperatures in the Northland just after 1:30 p.m. on February 8, 2026, range from 19 to 27 degrees Fahrenheit.

Wind speeds in the Northland just after 1:30 p.m. on February 8, 2026, range from 3 to 14 mph.  Wind direction is primarily from the south and southeast.

Wind speeds in the Northland just after 1:30 p.m. on February 8, 2026, range from 3 to 14 mph. Wind direction is primarily from the south and southeast.

Relative humidity levels in the Northland just after 1:30 p.m. on February 8, 2026, range from 34 to 68 percent.

Relative humidity levels in the Northland just after 1:30 p.m. on February 8, 2026, range from 34 to 68 percent.

#Happy #Sunday afternoon from the Northland!

It's a #seasonal February day for the region, but plenty of #cloud cover to go around.

We will see some possible #flurries and #drizzle in spots later this evening and tonight.

#wxtooter #weather #wx #MNwx #WIwx #UPwx

0 1 0 0
The satellite and radar over the Northland at 1:30 p.m. on February 5, 2026, shows cloudy skies for nearly all of the region.  The exception is some breakage in the Rainy River Basin.  Some drizzle and flurries are possible at times.

The satellite and radar over the Northland at 1:30 p.m. on February 5, 2026, shows cloudy skies for nearly all of the region. The exception is some breakage in the Rainy River Basin. Some drizzle and flurries are possible at times.

Temperatures in the Northland just after 1 p.m. on February 5, 2026, range from 27 to 36 degrees Fahrenheit.

Temperatures in the Northland just after 1 p.m. on February 5, 2026, range from 27 to 36 degrees Fahrenheit.

When compared to 1:30 p.m. on February 4, 2026, temperatures in the Northland this early Thursday afternoon are warmer than 24 hours ago by 7 to 18 degrees Fahrenheit.

When compared to 1:30 p.m. on February 4, 2026, temperatures in the Northland this early Thursday afternoon are warmer than 24 hours ago by 7 to 18 degrees Fahrenheit.

Wind speeds in the Northland just after 1 p.m. on February 5, 2026, range from 5 to 13 mph.  Wind direction is primarily from the west.

Wind speeds in the Northland just after 1 p.m. on February 5, 2026, range from 5 to 13 mph. Wind direction is primarily from the west.

Happy #Thursday afternoon from the #Northland!

For the first time in over three weeks, we are seeing above #freezing #temperatures in the region.

A passing #clipper system is bringing #drizzle and #flurries this afternoon, with more #snow #showers tonight.

#wxtooter #weather #wx #MNwx #WIwx #UPwx

0 0 0 0
Post image

📷 from the Vault

#photography #photo #photographer #artshare #fotografia #filmsky #artsky #photosky #booksky #moviesky #Photographie #Laphotographie #art #naturephotography #metaphysical #rain #bench #drizzle #picnic #picnictable #exteriors #landscapephotography #blackandwhite #bnwphotography #b&w

19 0 0 0
Original post on newsie.social

NORTHLAND FORECAST FOR FEBRUARY 5, 2026:

A #clipper system will bring scattered light #snow #showers through the #Northland Wednesday night. #Winds will be a bit #breezy with low #temperatures in the upper half of the teens.

Thursday will see #drizzle and #flurries during the daytime, with […]

0 1 1 0
Preview
Satirical Planet News: Weather, Tuesday 3 February 2026 Live from the Westminster Rake Observatory, Now Featuring a Returning Consultant Who Treats Consequences Like a Rebrand

Live from the Rake Observatory, Now Featuring a Returning Consultant Who Treats Consequences Like a Rebrand.
-
satiricalplanet.substack.com/p/satirical-...
-
#SatiricalPlanetNews #UKWeather #WeatherReport #Westminster #RakeIndex #BrokenBritain #Rain #Snow #Wind #England #Scotland #Drizzle

1 0 0 0
Post image

It’s RD at jpr in 🏴󠁧󠁢󠁷󠁬󠁳󠁿
#drizzle
#parkrun

4 0 1 0
Preview
Mizzle A light and type-safe ORM for DynamoDB built with TypeScript.

I have made an #drizzle like #orm for #dynamodb called #mizzle. Hope someone likes the idea.

mizzle-docs.vercel.app

0 0 0 0