🐄🐐🌱
Cow's, goat's and vegetable milk on the shelves
stock.adobe.com/contributor/...
#Cowsmilk #goatsmilk #vegetable #milk #shelves
#stockadobe #adobe #editorialphoto #supermarket #grocerystore
Latest posts tagged with #vegetable on Bluesky
🐄🐐🌱
Cow's, goat's and vegetable milk on the shelves
stock.adobe.com/contributor/...
#Cowsmilk #goatsmilk #vegetable #milk #shelves
#stockadobe #adobe #editorialphoto #supermarket #grocerystore
42日目。
#acrylic
#painting
#vegetable
#絵画
#野菜
#アクリル画
The pak choi of it all
#illustration #animation #aftereffects #vegetable #characteranimation
First asparagus! 🌱
#gardening #garden #vegetable #vegetablegarden
A pumpkin grown in Albany has beaten the previous WA record for heaviest pumpkin by nearly 60 kilograms. #horticulture #vegetable #crops #gardens #growing
I have questions.
#greenhouse #gardening #garden #vegetable #vegetablegarden
Image: eleven carrots laying on a stone background; Wisc.Jobs
It’s #InternationalCarrotDay! 🥕 This versatile #vegetable is great in cake, muffins or a salad! If you want a food service job, Winnebago Mental Health Inst in #OshkoshWI is hiring a #Cafeteria #FoodServiceAssistant. $17.64/hr +bnfts. Apply by 4/10. #WIjobs #GovJobs https://ow.ly/QpNm50YCXf9
41日目。
#acrylic
#painting
#vegetable
#絵画
#野菜
#アクリル画
After a chilly start to the day we've been able to get out into the #garden this afternoon. Now we're into April I've been able to #plant some more #vegetable #seeds into large pots and even #runner #beans into one of the large wooden tubs on wheels.
#sunshine #gardening #wellbeing #lovinglife
The cucumber plant in the laundry room at my house is cucumbering! While it is snowing outside... this is why I want to build a big hydroponic thing in that room. Norway just isn't for growing inside most of the year.
#greenhouse #gardening #garden #vegetable #vegetablegarden
Simple #Vegan Japanese-style #Vegetable #Soup 🌱 Ⓥ
Sweat garlic & onion in oil w salt. Add carrots & sweet potato, cook low. Deglaze w water & Ⓥ Dashi tinyurl.com/munzvmv8
Simmer gently w bay leaf. Add broccoli & tomato, finish w pepper.
www.youtube.com/watch?v=ncpf...
This Vegetable Soup Is a Natural Fat Burner! I Cook It Every Day Now. 🍜🍽️ #foodsky #soup #Vegetable #recipe
Full Recipe
Enjoy ❤️👇
www.worldrecipe.kozow.com/2026/03/this...
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #peruvianajiamarillochicken&quinoabowlswithcrispyplantains #peruvian #amarillo #chicken #quinoa #bowls #with #crispy #plantains #plantain #vegetable
Our 13 Best Carrot Side Dish Recipes Credit: Photographer: Robby Lozano, Food Stylist: Chelesa Zimmer , Prop Stylist: Lindsey Lower. Carrots are in season, so there’s no better time to add them t...
#Healthy #Recipes #Healthy #Side #Dish #Recipes #Healthy […]
[Original post on eatingwell.com]
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable
Five weeks later, there has been some progress. It's not very warm, and they got way too much light in the beginning, but we are definitely going somewhere with these four plants that I bought. My own seedlings are still small.
#greenhouse #gardening #garden #vegetable #vegetablegarden
How much do you know about food? Find out with this fun little 10-question quiz in the intellectual playground at 500ways.com/food-quiz ( #food, #cooking, #culinary, #vegetable, #meat, #eating, #diet, #dietary, #foodScience, #nutrition)
19 Kale Soups and Stews That Turn Greens Into Delicious Dinner Kale turns tender and silky when simmered in broth. Kale turns tender and silky when simmered in broth. Credit: Victor Protasio / Food...
#Food #Soups #Recipes #Greens #Vegetables #Ingredients […]
[Original post on foodandwine.com]
20 Melting Veggie Sides That Will Make Your Mouth Water Credit: Photographer: Robby Lozano, Food Stylist: Craig Ruff, Prop Stylist: Keoshia McGhee. These delicious recipes will have you dreaming of...
#Healthy #Recipes #Healthy #Side #Dish #Recipes #Healthy […]
[Original post on eatingwell.com]
Psylux is teaching Liam how to use the garden orb. #marowak #pokemon #cubone #fanart #garden #nintendoart #mountain #fairytype #gardening #tomato #pokesonaoc #tomatogarden #pokemonfanart #veggies #vegetable #nature #showing #showcase #pokemonart #sparkle #sprinkle #nintendofanart #tomatofarm #cute
Super excited to see that the three pots I planted with sprouting baby potatoes are showing signs of growing as they break through the surface & little leaves are beginning to show.
#potato #potatoes #leaves #leaf #sprouting #compost #pots #garden #vegetable
The celery experiment is starting to show some positive results. A couple of weeks ago I bought a celery head which went too soft too quickly, so on Alan's advice I cut a thin sliver off the base & stood it in some water.
#celery #plant #roots #healthy #vegetable #garden #gardening #pot
Valentin by Andrea Ehrenreich https://www.artlimit
#shotwithlove #colour #instant #conceptual #shootfilmstaybroke #visiblewomen #nature #vegetable #analogphotography #film #photography #onfilm #color #vegetal #colors #love #fruit #photographylovers #filmphotography